organ dan sistem organ pada tumbuhan

12 November 2017 21:55:33 Dibaca : 59

PRAKTIKUM IV

A. Judul
Organ dan Sistem Organ Pada Tumbuhan
B. Tujuan Praktikum
1. Menjelaskan derivat-derivat organ pokok tumbuhan
2. Menjelaskan bagian-bagian akar pada tumbuhan
3. Menjelaskan bagian-bagian batang pada tumbuhan
4. Menjelaskan bagian-bagian daun pada tumbuhan
5. Menyebutkan bagian-bagian dari alat reproduksi pada tumbuhan

C. Dasar Teori
Tumbuhan mempunyai 3 organ pokok disebut sebagai tumbuhan cormofita. 3 organ pokok tersebut yakni akar (radiks), batang (caulis), dan daun (folium). Maka, apabila tanaman tidak memiliki salah satu organ pokok tidak termasuk dalam tanaman cormofita.Sedangkan bagian lain dari tumbuhan dianggap sebagai turunan (derivat) dari salah satu atau dua bagian pokok tersebut yang telah mengalami perubahan bentuk, sifat, dan fungsi(Team penyusun,2017).
1. Akar (radiks)
Akar yaitu bagian pokok dari tumbuhan, bagian bawah sumbu tumbuhan dan biasanya tumbuh di dalam tanah (namun ada pula yang di udara misalnya pada anggrek epifit), dengan arah tumbuh ke pusat bumi atau menuju ke air dan meninggalkan cahaya. Berbeda dengan batang, maka akar tidak berbuku, tidak beruas, dan tidak mendukung daun atau bagian-bagian lainnya. Akar tumbuh terus pada ujungnya, bentuknya sering kali meruncing dan warnanya biasanya keputihan atau kekuningan.
Akar berfungsi memperkuat berdirinya tumbuhan, untuk menyerap air dan zat-zat makanan yang terlarut didalam air dari dalam tanah, mengangkut air dan zat-zat makanan ke tempat tubuh tumbuhan yang memerlukan, dan kadang-kadang sebagai tempat untuk penimbunan makanan(Depdiknas,2000).

Pada umumnya akar dapat dibedakan bagian-bagian berikut:
a) Akar primer, yaitu akar utama yang merupakan pangkal dari batang akar.
b) Ujung akar, ialah bagian akar yang paling muda, terdiri atas jaringan yang masih dapat mengadakan pertumbuhan.
c) Leher akar, ialah bagian akar yang bersambungan dengan pangkal batang. Juga sebagai pembatas antara batang bagian atas dan akar.
d) Serabut akar, yaitu cabang-cabang akar yang lebih halus dan berbentuk serabut.
e) Batang akar, ialah bagian akar yang terdapat pada antara ujung akar dan leher akar.
f) Tudung akar, ialah bagian akar yang letaknya paling ujung, terdiri atas jaringan yang berguna untuk melindungi akar yang masih muda dan lemah.
g) Cabang-cabang akar, ialah bagian-bagian akar yang tidak langsung bersambungan dengan pangkal batang.
Akar biasanya mempunyai sifat-sifat berikut :
1). Merupakan bagian tumbuhan yang biasanya terdapat didalam tanah dengan arah tumbuh ke pusat bumi atau menuju ke air, meninggalkan udara dan cahaya.
2) Tidak berbuku-buku dan tidak beruas.
3). Warna tidak hijau, biasanya keputih-putihan atau kekuning-kuningan.
4) tumbuh terus pada ujungnya.
5) bentuknya seing kali meuncing.
Fungsi akar bagi tumbuhan ;
a. Memperkuat bedirinya tumbuhan.
b. Untuk menyerap air dan zat-zat makanan dari dalam tanah.
c. Mengangkut air dan zat-zat makanan ke tempat-tempat pada tubuh tumbuhan yang memerlukan.
d. Untuk penimbunana makanan atau penyimpanan cadangan makanan.
2. Batang (caulis)
Batang merupakan bagian sistem pucuk yang tumbuh di atas tanah dan merupakan bagian terpenting dari tumbuhan. Sistem pucuk yang khas terdiri dari sebuah batang utama yang menyangga daun, batang, dan kadang-kadang bunga.
Batang selalu berujung pada kuncup yang tersusun atas sejumlah daun kecil yang mengelilingi dan menyelubungi bagian pusat kuncup itu dan yang disebut ujung batang. Batang pada umumnya berbentuk panjang, bulat seperti silinder atau dapat pula mempunyai bentuk lain. Pada tumbuhan berkeping dua, batang yang di bagian bawahnya lebih besar dan ke ujung makin mengecil, dan dapat mempunyai percabangan atau tidak. Tumbuhan berkeping tunggal sebaliknya mempunyai batang yang dari pangkal ujung boleh dikatakan tidak ada perbedaan besarnya dan hanya pada beberapa golongan saja yang pangkalnya tampak membesar tetapi selanjutnya ke atas sama, seperti terlihat pada bermacam-macam tumbuhan palma (palmae).
Adapun bagian-bagian dari batang :
a) Buku-buku batang, merupakan tempat melekatnya daun dan tempat untuk tumbuhnya tunas baru.
b) Ruas batang, merupakan bagian diantara dua buku-buku yang berurutan.
c) Daun penumpu, yang biasanya berupa dua helai lembaran serupa daun yang kecil, yang terdapat dekat pangkal tangkai daun dan umumnya berguna untuk melindungi kuncup yang masih muda.
Pada umumnya batang memiliki sifat-sifat sebagai berikut :
1. Umumnya berbentuk panjang bulat seperti silinder atau dapat pula bentuk lain.
2. Terdiri atas ruas-ruas yang masing-masing dibatasi oleh buku-buku.
3. Tumbuh biasanya ke atas.
4. Selalu bertambah panjang pada ujungnya.
5. Mengadakan percabangan dan selama hidupnya tumbuhan tidak digugurkan kecuali kadang-kadang cabang atau ranting yang kecil.
Batang mempunyai tugas untuk :
1. Mendukung bagian-bagian tumbuhan yang ada di atas tanah.
2. Daya percabangannya memperluas bidang asimilasi dan membuat posisi yang menguntungkan bagi tumbuhan.
3. Jalan pengangkutan air dan zat-zat makanan dari bawah ke atas dan jalan pengangkutan hasil-hasil asimilasi dari atas ke bawah.
4. Menjadi tempat penimbunan zat-zat cadangan makanan.
3. Daun (folium)
Daun merupakan salah satu organ tumbuhan yang tumbuh dari batang, umumnya berwarna hijau dan terutama berfungsi sebagai penangkap energi dan cahaya matahari melalui fotosintesis. Fungsi dari daun ialah sebagai tempat terjadinya fotosintesis pada tumbuhan dikotil, terjadi fotosintesis di jaringan parenkim palisade atau tumbuhan monokotil terjadi pada jaringan spons, sebagai organ pernafasan dan tempat terjadinya transpirasi(Tjitrosoepomo,1985).
Adapun bagian-bagian dari daun ialah :
a) Upih atau pelepah daun, merupakan bagian daun yang melekat atau memeluk batang.
b) Tangkai daun, merupakan bagian daun yang helaiannya dan bertugas untuk menempatkan helaian daun pada posisi sedemikian rupa.
c) Helaian daun, merupakan bagian daun yang kurang ataupun lokasi menarik perhatian.
d) Tulang daun
e) Ibu tulang daun

4. Alat reproduksi (Bunga)
Bunga merupakan alat reproduksi. Bunga dibentuk oleh meristem ujung khusus yang berkembang dari ujung pucuk vegetatif setelah dirangsang oleh faktor-faktor internal dan eksternal untuk keperluan itu.
Bunga yang mempunyai organ kelopak, mahkota, stamen, dan putik disebut bunga lengkap. Namun kebanyakan bunga mempunyai struktur tidak lengkap, misalnya tidak mempunyai salah satu alat kelamin atau keduanya sehingga disebut hermaprodit. Bila hanya memiliki alat kelamin jantan saja disebut bunga jantan, dan sebaliknya bila hanya memiliki putik saja disebut bunga betina. Bila kedua macam bunga uniseksual itu terdapat pada satu tumbuhan maka disebut berumah satu bila terpisah disebut berumah dua. Tumbuhan yang mempunyai bunga sempurna (biseksualis), bunga jantan dan bunga betina disebut poligam(Hadiat,2000).
Pada umumnya bunga mempunyai sifat-sifat sebagai berikut :
1. Mempunyai warna menarik.
2. Biasanya bebau harum.
3. Bentuknya bermacam-macam (bervariasi).
4. Biasanya mengandung madu
Adapun bagian bunga lengkap yaitu :
1. Daun pelindung (braktea)
2. Daun tangkai (brakteola)
3. Tangkai induk (pedunculusi)
4. Tangkai bunga (pedicelusi)
5. Dasar bunga (reseptakulum)
6. Daun kelopak (cepalia)
7. Daun mahkota (petala)
8. Benang sari (stamen)
9. Putik (pestilum)
Bagian fertil terdiri dari mikrosporofil sebagai benang sari dan makrosporofil sebagai putik (pisitillum) dengan daunbuah sebagai penyusunnya. Disamping itu pada bagian tumbuhan tertentu kadang-kadang masih dapat ditentukan alat-alat lain lagi yang biasanya lebih kecil atau lebih halus yang dinamakan alat tambahan atau alat pelengkap (organa acceseria) misalnya :
1. Rambut atau bulu (pilus)
2. Sisik (lepis)
3. Lentisel (lenticulus)

D. Alat dan Bahan
1. Tanaman Amaranthus spinosus
2. Tanaman Zea mays
3. Tanaman Musa paradisiaca
4. Tanaman Caesalpinia pulcherrima
5. Kertas
6. Pensil
7. Penghapus
E. Prosedur Kerja

Menuliskan nama jenis dan suku dari sediaan preparat
Menyebutkan sistem perakarannya lalu menggambar akar secara skematis dan memberi keterangan bagian-bagiannya, misal
1) Akar primer 5) ujung akar
2) Leher akar 6) serabut akar
3) Batang akar 7) tudung akar
4) Cabang-cabang akar

Menuliskan nama jenis dan suku dari sediaan preparat.
Menggambar skema akar dan memberi keterangan bagian-bagian:
1) Buku-buku batang (nodus)
2) Ruas batang (internodus)
3) Daun penumpu (stipula)

Menuliskan nama jenis dan suku dari sediaan preparat.
Menyebutkan apakah daun yang ada termasuk daun lengkap atau tidak lengkap
Menggambar secara skematis sehelai daun dan memberikan keterangan mengenai:
1) Pangkal daun (basis)
2) Ujung daun (apeks)
3) Tepi daun (margo)
4) Pertulangan daun ( nervasio)
5) Ibu tulang daun

a) Menuliskan nama jenis dan suku dari sediaan preparat
b) Kemudian menggambar dan memberikan keterangan mengenai:
1) Daun pelindung (braktea) 6) daun kelopak (cepalia)
2) Daun tangkai (brakteola) 7) daun mahkota (petala)
3) Tangkai induk (pedunculusi) 8) benag sari (stamen)
4) Tangkai bunga ( pedicelusi) 9) putik(pistilium)
5) Dasar bunga (reseptakulum)

F. Hasil Praktikum
1. Klasifikasi Amaranthus spinosus
Kingdom : Plantae
Divisi : Magnoliophyta
Kelas : Magnoliopsida
Ordo : Caryophyllales
Famili : Amaranthaceae
Genus : Amarantus
Spesies : Amaranthus spinosus L

2. Klasifikasi Zea mays
Kingdom : Plantae
Divisi : Magnoliophyta
Kelas : Liliopsida
Ordo : Poales
Famili : Poaceae
Genus : Zea
Spesies : Zea mays

3. Klasifikasi Musa paradisiaca
Kingdom : Plantae
Divisi : Magnoliophyta
Kelas : Liliopsida
Ordo : Zingiberales
Famili : Musaceae
Genus : Musa
Spesies : Musa paradisiaca
4. Klasifikasi Caesalpinia pulcherrima
Kingdom : Plantae
Divisi : Magnoliophyta
Kelas : Magnoliopsida
Ordo : Fabales
Famili : Fabaceae
Genus : Caesalpinia
Spesies : Caesalpinia pulcherrima
1. Akar
a. Akar tanaman Amaranthus spinosus tediri dari :
1. Leher akar
2. Cabang akar
3. Akar primer
4. Serabut akar
5. Tudung akar
6. Ujung akar

b. Akar tanaman Zea mays terdiri dari :
1. Batang akar
2. Serabut akar
3. Cabang akar
4. Tudung akar
5. Ujung akar

c. Akar tanaman Musa paradisiaca terdiri dari :

1. Batang akar
2. Cabang akar
3. Rambut akar
4. Ujung akar
5. Tudung akar
d. Akar tanaman Caesalpinia pulcherrima terdiri atas :

1. Akar primer
2. Batang akar
3. Akar serabut
4. Tudung akar
5. Ujung akar
6. Rambut akar

2. Batang
a. Batang tanaman Amaranthus spinosus

1. Duri batang
2. Ruas batang

b. Batang tanaman Zea mays terdiri atas :

1. Ruas batang
2. Buku-buku batang
3. Internodus
c. Batang tanaman Musa paradisiaca tediri atas :

1. Internodus
2. Pelepah

d. Batang tanaman Caesalpinia pulcherrima terdiri atas :

1. Duri batang
2. Daun penumpu

3. Daun
a. Daun tanaman Amaranthus spinosus

1. Ujung daun
2. Pertulangan daun
3. Ibu tulang daun
4. Tepi daun
5. Pangkal daun
6. Tangkai daun

b. Daun tanaman Zea mays terdiri atas :

1. Ujung daun
2. Ibu tulang daun
3. Tepi daun
4. Pangkal daun
5. Pelepah daun

c. Daun tanaman Musa paradisiaca tediri atas :

1. Ujung daun
2. Ibu tulang daun
3. Tepi daun
4. Pangkal daun
5. Pelepah daun

d. Daun tanaman Caesalpinia pulcherrima terdiri atas :

1. Ujung daun
2. Petulangan daun
3. Ibu tulang daun
4. Tepi daun
5. Pangkal daun

4. Bunga
a. Bunga tanaman Caesalpinia pulcherrima terdiri atas :

1. Daun mahkota
2. Dasar bunga
3. Kelopak
4. Benang sari
5. Putik
6. Bakal buah
7. Tangkai bunga
8. Tangkai induk

b. Bunga tanaman Amaranthus spinosus terduru atas :

1. Tangkai bunga
2. Putik

G. Pembahasan
Dari hasil pengamatan tentang ogan tumbuhan, maka dapat kita bedakan bagian-bagian organ tumbuhan diantaranya:
1. Akar (radiks)
Bentuk dan struktur akar sangat beragam. Keanekaragaman akar ini bertalian dengan fungsinya, misalnya sebagai akar nafas, sebagai akar penyimpan cadangan makanan, sebagai akar pelekat, sebagai akar penghisap, sebagai akar penopang, dan sebagainya.
Bagian-bagian akar dapat dibedakan atas:
a) Akar primer yaitu akar utama yang merupakan pangkal dari batang akar.
b) Ujung akar ialah bagian akar yang paling muda, terdiri atas jaringan yang masih dapat mengadakan pertumbuhan.
c) Leher akar ialah bagian akar yang bersambungan dengan pangkal batang.
d) Serabut akar yaitu cabang-cabang akar yang lebih halus dan berbentuk serabut.
e) Batang akar ialah bagian akar yang terdapat pada antara ujung akar dan leher akar.
f) Tudung akar ialah bagian akar yang letaknya paling ujung, terdiri atas jaringan yang berguna untuk melindungi akar yang masih muda dan lemah.
g) Cabang-cabang akar ialah bagian-bagian akar yang tidak langsung bersambungan dengan pangkal batang.
Sebagai sumbu tumbuhan di dalam tanah, seperti halnya batang (sumbu di atas tanah), akar akan tumbuh memanjang secara terus-menerus sebagai akibat pertumbuhan ujungnya.
Sitem pada akar tebagi atas 2 macam, yaitu:
a. Sistem akar tunggang, jika akar lembaga tumbuh terus menjadi akar pokok yang bercabang-cabang, menjadi akar-akar yang lebih kecil. Akar pokok yang berasal dari akar lembaga disebut akar tunggang (radiks primaria). Susunan akar yang demikian ini biasa terdapat pada tumbuhan biji belah (dikotiledoneae) dan tumbuhan biji telanjang (gymnospermae). Contoh: Amarathus spinosus bersistem akar tunggang
b. Sistem akar serabut, yaitu jika akar lembaga dalam perkembagan selanjutnya mati atau kemudian disusul oleh sejumlah akar yang kurang lebih sama besar dan semuanya keluar dari pangkal batang. Akar-akar ini karena bukan berasal dari calon akar yang asli dinamakan akar liar, bentuknya seperti serabut, oleh karena itu, dinamakan akar serabut (radiks adventicia).
Terjadi bila akar lembaga dalam perkembangan selanjutnya mati atau kemudian disusul oleh perkembangannya sejumlah akar yang kurang lebih sama besar dan semuanya berasal dari pangkal batang. Akar-akar ini karena bukan berasal dari calon akar yang asli disebut akar linear, bentuknya seperti serabut, oleh karena itu disebut akar serabut. Umumnya terdapat pada tumbuhan yang tergolong monokotil.
Akar dapat pula berubah bentuk karena fungsinya berbeda dengan fungsi asal. Hal ini dapat disebabkan oleh karena penyesuaian cara hidupnya dengan keadaan-keadaan tertentu.
Dari hasil pengamatan yang telah dilakukan di dapat data sebagai beikut :
1. Akar tanaman Amaranthus spinosus tediri dari :
a. Leher akar adalah bagian yang bersambungan dengan batang dan akar.
b. Cabang akar adalah bagian-bagian akar yang tidak langsung bersambungan dengan pangkal batang.
c. Akar primer adalah akar utama yang merupakan pangkal dari batang akar.
d. Serabut akar adalah cabang-cabang akar yang lebih halus dan berbentuk serabut.
e. Tudung akar adalah bagian akar yang letaknya paling ujung, terdiri atas jaringan yang berguna untuk melindungi akar yang masih muda dan lemah.
f. Ujung akar adalah bagian akar yang paling muda, terdiri atas jaringan yang masih dapat mengadakan pertumbuhan.
2. Akar tanaman Zea mays terdiri dari :
a. Batang akar adalah bagian akar yang terdapat pada antara ujung akar dan leher akar.
b. Serabut akar adalah cabang-cabang akar yang lebih halus dan berbentuk serabut.
c. Cabang akar adalah bagian-bagian akar yang tidak langsung bersambungan dengan pangkal batang.
d. Tudung akar adalah bagian akar yang letaknya paling ujung, terdiri atas jaringan yang berguna untuk melindungi akar yang masih muda dan lemah.
e. Ujung akar adalah bagian akar yang paling muda, terdiri atas jaringan yang masih dapat mengadakan pertumbuhan.
3. Akar tanaman Musa paradisiaca terdiri dari :
a. Batang akar adalah bagian akar yang terdapat pada antara ujung akar dan leher akar.
b. Cabang akar adalah bagian-bagian akar yang tidak langsung bersambungan dengan pangkal batang.
c. Rambut akar adalah cabang-cabang akar yang lebih halus dan berbentuk serabut.
d. Ujung akar adalah bagian akar yang paling muda, terdiri atas jaringan yang masih dapat mengadakan pertumbuhan.
e. Tudung akar adalah bagian akar yang letaknya paling ujung, terdiri atas jaringan yang berguna untuk melindungi akar yang masih muda dan lemah.
4. Akar tanaman Caesalpinia pulcherrima terdiri dari :
a. Akar primer akar utama yang merupakan pangkal dari batang akar.
b. Batang akar adalah bagian akar yang terdapat pada antara ujung akar dan leher akar.
c. Tudung akar adalah bagian akar yang letaknya paling ujung, terdiri atas jaringan yang berguna untuk melindungi akar yang masih muda dan lemah.
d. Ujung akar adalah bagian akar yang paling muda, terdiri atas jaringan yang masih dapat mengadakan pertumbuhan.
e. Rambut akar adalah cabang-cabang akar yang lebih halus dan berbentuk serabut.
2. Batang (caulis)
Batang selalu berujung pada kuncup yang tersusun atas sejumlah daun kecil yang mengelilingi dan menyelubungi bagian pusat kuncup itu dan yang disebut ujung batang. Batang pada umumnya berbentuk panjang, bulat seperti silinder atau dapat pula mempunyai bentuk lain. Pada tumbuhan berkeping biji dua, batang yang di bagian bawahnya lebih besar dan ke ujung makin mengecil, dan dapat mempunyai percabangan atau tidak. Tumbuhan berkeping biji tunggal sebaliknya mempunyai batang yang dari pangkal ujung boleh dikatakan tidak ada perbedaan besarnya dan hanya pada beberapa golongan saja yang pangkalnya tampak membesar tetapi selanjutnya ke atas sama, seperti terlihat pada bermacam-macam palma.
Batang dapat dibagi menjadi buku (yaitu tempat melekatnya daun) dan ruas (yaitu bagian di antara dua buku yang berurutan). Buku ini pada beberapa tumbuhan terdiri dari sel-sel yang hanya sedikit tumbuh memanjang, sedangkan ruasnya terdiri dari sel-sel yang agak lebih panjang (misalnya rumput, bambu, dan tebu). Kadang-kadang buku ini jelas sekali kelihatan karena daerah ini membengkak. Pada tumbuhan yang tergolong Dicotyledoneae biasanya mempunyai ruas yang tidak nyata, sedangkan pada golongan tumbuhan Monocotyledoneae umumnya mempunyai ruas-ruas yang sangat nyata. Pada batang padi, tebu, mempunyai buku,ruas, dan daun penumpu yang nampak jelas. Sedangkan pada batang bayam duri dan kembang merak, pada umumnya batang di bagian bawahnya lebih besar dan ke ujung makin mengecil dan mempunyai percabangan.
Adapun bagian-bagian batang yang diperoleh yaitu :
1. Batang tanaman Amaranthus spinosus terdiri dari :
a. Duri batang adalah derivat yang tumbuh pada batang yang berupa tonjolan tajam.
b. Ruas batang adalah bagian yang berada diantara buku-buku batang.
2. Batang tanaman Zea mays terdiri dari :
a. Ruas batang bagian yang berada diantara buku-buku batang.
b. Buku-buku batang adalah bagian dari tumbuhan yang berada pada batang yang berfungsi sebagai tempat melekatnya daun.
c. Internodus biasanya terletak diatas nodus.
3. Batang tanaman Musa paradisiaca terdiri dari :
a. Pelepah (batang semu) adalah bagian batang yang berlapis-lapis yang berbentuk bulat pipih.
4. Batang tanaman Caesalpinia pulcherrima terdiri dari :
a. Duri batang adalah derivat yang tumbuh pada batang yang berupa tonjolan tajam.
b. Daun penumpu biasanya tumbuh di ketiak batang.

c. Daun (folium)
Pada tanaman jagung daunnya merupakan daun berupih dengan pertulangan sejajar. Adapun bagian yang terdapat pada daun tanaman ini adalah ujung daun, tepi daun, ibu tulang daun, dan pangkal daun. Bentuk ujung daun meruncing, sedangkan pada bayam duri bentuk ujung daunnya runcing dengan pertulangan daun menyirip. Bagian-bagian dari bayam duri adalah ujung daun, pertulangan daun, tepi daun, ibu tulang daun, dan pangkal daun. Sedangkan daun bunga merak merupakan daun majemuk menyirip genap dengan jumlah anak daun yang genap dengan ujung daun yang membulat.
Adapun bentuk daun dan bagian-bagiannya dari hasil pengamatan yaitu sebagai berikut :
1. Daun tanaman Amaranthus spinosus terdiri dari :
a. Ujung daun pada umumnya ujung dapat memperlihatkan beraneka rupa. Bentuk-bentuk ujung daun ada yang meruncing, runcing, tumpul, dam majemuk.
b. Pertulangan daun adalah bagian daun yang berguna untuk memberikan kekuatan pada daun.
c. Ibu tulang daun adalah tulang yang biasanya tersebar, merupakan terusan tangkai daun dan terdapat ditengah-tengah, membujur dan membelah daun.
d. Tepi daun mempunyai perbedaan bentuk tepi daun di akibatkan karena adanyan torehan (snius) ini menimbulkan adanya tonjolan (angulus) di tepi daun. Torehan tersebut dapat mempengaruhi bentuk helaian daun dan dapat pula tidak.
e. Pangkal daun adalah pembatas antara helaian daun dengan tangakai daun.
f. Tangkai daun adalah bagian dari batang tumbuhan yang berfungsi menghubungkan batang dengan daun. Biasanya tangkai daun melekat pada batang.
2. Daun tanaman Zea mays terdiri dari :
a. Ujung daun pada tanaman jagung (Zea mays) biasanya berbentuk meruncing.
b. Ibu tulang daun adalah bagian tulang daun yang membelah daun, biasanya berada di tengah-tengah daun dan merupakan terusan dari tangkai daun.
c. Tepi daun biasanya berbentuk bermacam-macam. Pada tumbuhan jagung bentuk tepi daun berbentuk sejajar.
d. Pangkal daun pada jagung berbentuk pelepah yang merupakan jarak antara daun dengan batang,
e. Pelepah daun biasanya berbentuk bulat pipih.

3. Daun tanaman Musa paradisiaca terdiri dari :
a. Ujung daun pisang biasanya berbentuk meruncing.
b. Ibu tulang daun dalah bagian tulang daun yang membelah daun dan biasanya berada di tengah-tengah daun.
c. Tepi daun adalah bagian yang membedakan bentuk daun. Pada daun pisang bentuk sejajar.
d. Pangkal daun pisang memiliki ciri-ciri sama seperti daun jaung.
e. Pelepah daun adalah bagian yang berhubungan langsung dengan batang semu.
4. Daun tanaman Caesalpinia pulcherrima terdiri dari :
a. Ujung daun dari kembang merak berbentuk bulat majemuk
b. Petulangan daun adalah bagian daun yang berguna untuk memberikan kekuatan pada daun.
c. Ibu tulang daun adalah tulang yang biasanya tersebar, merupakan terusan tangkai daun dan terdapat ditengah-tengah, membujur dan membelah daun.
d. Tepi daun mempunyai perbedaan bentuk tepi daun di akibatkan karena adanyan torehan (snius) ini menimbulkan adanya tonjolan (angulus) di tepi daun. Torehan tersebut dapat mempengaruhi bentuk helaian daun dan dapat pula tidak
e. Pangkal daun pembatas antara helaian daun dengan tangakai daun.
d. Bunga
Pada umumnya, bagian-bagian bunga yang terdapat pada suatu bunga adalah putik, benang sari, daun mahkota, daun kelopak, dasar bunga, tangkai bunga, daun pelindung. Bunga yang mempunyai organ kelopak, mahkota, stamen, dan putik disebut bunga lengkap. Namun kebanyakan bunga mempunyai struktur tidak lengkap, misalnya tidak mempunyai salah satu alat kelamin atau keduanya. Bila hanya memiliki alat kelamin jantan saja disebut bunga jantan, dan sebaliknya bila hanya memiliki putik saja disebut bunga betina. Bila kedua macam bunga uniseksual itu terdapat pada satu tumbuhan maka disebut berumah satu bila terpisah disebut berumah dua. Tumbuhan yang mempunyai bunga sempurna (biseksualis), bunga jantan dan bunga betina disebut poligam.
Bagian- bagian bunga terdiri atas:
a. Putik merupakan bagian bunga yang paling dalam letaknya dan merupakan alat kelamin betina.
b. Benang sari merupakan alat kelamin jantan.
c. Daun mahkota yaitu bagian hiasan bunga yang terdapat pada lingkaran dalam, biasanya tidak berwarna hijau lagi. Bagian inilah yang lazimnya merupakan warna bunga.
d. Daun kelopak merupakan bagian hiasan bunga yang merupakan lingkaran luar. Biasanya berwarna hijau yang melindungi kuncup terhadap pengaruh-pengaruh dari luar.
e. Dasar bunga merupakan ujung tangkai bunga yang mendukung bagian-bagian bunga lainnya.
f. Tangkai bunga adalah cabang ibu tangkai yang mendukung bunganya.
g. Daun pelindung merupakan bagian-bagian serupa daun yang dari ketiaknya muncul cabang-cabang ibu tangkai atau tangkai bunganya.
Pada tumbuhan yang berbunga seperti Caesalpinia pulcherima memiliki bagian-bagian bunga lengkap karena semua penyusun bunga ada. Adapun penyusun bunga kembang merak adalah sebagai berikut :
a. Tangkai bunga
b. Kelopak bunga
c. Dasar bunga
d. Bakal buah
e. Mahkota
f. Putik
g. Benang sari
h. Tangkai putik

H. Kesimpulan
Dari hasil penelitian dapat kami simpulkan bahwa tumbuhan mempunyai 3 organ pokok disebut sebagai tumbuhan cormofita. Sedangkan bagian lain dari tumbuhan dianggap sebagai turunan (derivat) dari salah satu atau dua bagian pokok tersebut yang telah mengalami perubahan bentuk, sifat, dan fungsi 3 organ pokok tersebut yakni akar (radiks), merupakan bagian bawah sumbu tumbuhan dan biasanya tumbuh di dalam tanah (namun ada pula yang di udara misalnya pada anggrek epifit), dengan arah tumbuh ke pusat bumi atau menuju ke air dan meninggalkan cahaya. Bagiannya ialah Akar primer, ujung akar, leher akar, serabut akar, batang akar, tudung akar, dan cabang-cabang akar. Batang (caulis), merupakan bagian sistem pucuk yang tumbuh di atas tanah. Sistem pucuk yang khas terdiri dari sebuah batang utama yang menyangga daun, batang, dan kadang-kadang bunga dan daun (folium) merupakan salah satu organ tumbuhan yang tumbuh dari batang, umumnya berwarna hijau dan terutama berfungsi sebagai penangkap energi dan cahaya matahari melalui fotosintesis. Fungsi dari daun ialah sebagai tempat terjadinya fotosintesis pada tumbuhan dikotil, terjadi fotosintesis di jaringan parenkim palisade/tumbuhan monokotil terjadi pada jaringan spons, sebagai organ pernafasan dan tempat terjadinya transpirasi.

I. jawaban Tugas
1. Jelaskan perbedaan daun lengkap dan daun tidak lengkap dan beri contoh tanaman masing-masing.
2. Gambarkan struktur morfologi bunga sempurna
3. Sebutkan dan jelaskan derivat-derivat dari akar, batang, dan daun.
Jawab
1. Daun lengkap ialah daun yang mempunyai bagian-bagian yaitu, upih atau pelepah daun, tangkai daun, dan helaian-helaian daun. Contoh : Tanaman Pohon pisang (Musa paradisiaca). Sedangkan daun yang tidak lengkap ialah daun yang kehilangan satu, dua, atau tiga bagian dari daun. Contoh: Tanaman Padi (Oryza sativa) dan tanaman tebu (Saccharum officinarum).
2.

3. Akar
 Akar primer, yaitu akar utama yang merupakan pangkal dari batang akar.
 Ujung akar, ialah bagian akar yang paling muda, terdiri atas jaringan yang masih dapat mengadakan pertumbuhan.
 Leher akar, ialah bagian akar yang bersambungan dengan pangkal batang.
 Serabut akar, yaitu cabang-cabang akar yang lebih halus dan berbentuk serabut.
 Batang akar , ialah bagian akar yang terdapat pada antara ujung akar dan leher akar.
 Tudung akar, ialah bagian akar yang letaknya paling ujung, terdiri atas jaringan yang berguna untuk melindungi akar yang masih muda dan lemah.
 Cabang-cabang akar, ialah bagian-bagian akar yang tidak langsung bersambungan dengan pangkal batang.
Batang
 Buku-buku batang, merupakan tempat daun melekat.
 Ruas batang, merupakan bagian diantara dua buku-buku yang berurutan.
 Daun penumpu, yang biasanya berupa dua helai lembaran serupa daun yang kecil, yang terdapat dekat pangkal tangkai daun dan umumnya berguna untuk melindungi kuncup yang masih muda.
Daun
 Upih atau pelepah daun, merupakan bagian daun yang melekat atau memeluk batang.
 Tangkai daun, merupakan bagian daun yang helaiannya dan bertugas untuk menempatkan helaian daun pada posisi sedemikian rupa.
 Helaian daun, merupakan bagian daun yang kurang ataupun lokasi menarik perhatian.

Daftar Pustaka
Depdiknas. 2003. Ensiklopedi Sains dan Kehidupan. Jakarta : CV. Tarity samudra berlian
Hadiat, dkk. 2000. Kamus Besar Ilmu Pengetahuan. Jakarta : Balai Pustaka
Team, teaching. 2017. Penuntun Praktikum Biologi. Gorontalo. UNG
Tjitrosoepomo, gembong. 1985. Morfologi Tumbuhan. Yogyakarata: UGM

 

jaringan penyusun tubuh hewan

12 November 2017 21:52:32 Dibaca : 37

¬¬PRAKTIKUM V
A. Judul
Jaringan Penyusun Tubuh Hewan
B. Tujuan Praktikum
Setelah praktikum diharapkan siswa dapat mempelajari ciri-ciri dan struktur histologis dari jaringan epitel, jaringan pengikat dan jaringan otot.
C. Dasar Teori
1. Jaringan penyusun tubuh hewan
Tubuh hewan terdiri atas jaringan-jaringan atau sekelompok sel yang mempunyai struktur dan fungsi yang sama. Jaringan dengan struktur yang khusus memungkinkan mereka mempunyai fungsi yang spesifik. Sebagai contoh, otot-otot jantung yang bercabang menghubungkan sel-jantung yang lainnya. Percabangan tersebut membantu kontraksi sel-sel dalam satu koordinasi. Ilmu yang mempelajari jaringan disebut histologi.
Jaringan didalam tubuh hewan mempunyai sifat yang khusus dalam melakukan fungsinya, seperti peka dan pengendali (jaringan saraf), gerakan (jaringan otot), penunjang dan pengisi tubuh (jaringan ikat), absorbsi dan sekresi (jaringan epitel), bersifat cair (darah) dan lainnya. Masing-masing jaringan dasar dibedakan lagi menjadi beberapa tipe khusus sesuai dengan fungsinya. Padasaat perkembangan embrio, lapisan kecambah (germ layers) berdiferensiasi (dengan proses yang disebut histogenesis) menjadi empat macam jaringan utama, yaitu:
a. Jaringan epitel
Jaringan epitel merupakan jaringan yang membatasi tubuh dengan lingkungannya, baik disebelah luar maupun disebelah dalam seperti dinding usus, pembuluh darah dan lain-lain. Jaringan epitel berupa epitel selaput pipih, epitel selapis kubus, epitel selapis silindris, epitel berlapis pipih dan epitel selapis semu silindris.
Jaringan epitel terdiri atas satu atau banyak lapis sel, yang menutupi permukaan dalam dan luar suatu organ. Secara embriologi, jaringan ini berasal dari lapisan ektoderm, mesoderm atau endoderm. Di bagian tubuh luar, epitel ini membentuk lapisan pelindung, sedangkan pada bagian dalam tubuh, jaringan epitel terdapat disepanjang sisi organ. Jaringan epitel dibedakan berdasarkan bentuk dan jumlah lapisan sel penyusunnya, yaitu :
i. Epitelium satu lapis (simple epithelium). Epithel ini terdiri atas sel-sel berbentuk pipih, kubus, dan silindris (batang). Epithelium pipih selapis ditemukan antara lain pada lapisan endotel pembuluh darah. Epithelium bentuk kubus ditemukan pada kelenjar tyroid dan pembuluh darah. Epithel berbentuk silindris (batang) ditemukan pada lambung dan usus.
ii. Epitelium berlapis banyak (stratified epithelium) yang dibentuk oleh beberapa lapis sel yang berbentuk pipih, kuboid, atau silindris. Epithelium ini dapat ditemukan pada kulit, kelenjar keringat, dan uretra. Beberapa lapisan pada epitheliun ini dapat berubah menjadi sel-sel yang memanjang dan disebut epithelium transisional. Epitel transisional ditemukan pada kandung kemih (vesica urinaria). Disamping itu, terdapat epithelium berlapis banyak semu (pseudostratified epithelium) yang ditemukan pada trakea.
Epitel pipih berlapis, seperti yang terdapat di pemukaan kulit kita, mampu melakukan mitosis dengan cepat. Sel-sel baru hasil mitosis menggantikan sel-sel permukaan yang mati. Epitel ini juga sebagai pelindung oragan terhadap abrasi oleh makanan yang kasar, seperti yang ditemukan pada esofagus. Sebaliknya, epitelium pipih selapis berukuran tipis dan lemah, yang cocok untuk pertukaran material dengan cara difusi. Epitel ini ditemukan pada dinding kapiler darah dan alveoli paru-paru.
b. Jaringan Ikat
Jaringan ikat berfungsi untuk menunjang tubuh, dibentuk oleh sel-sel dalam jumlah sedikit. Jaringan ikat terdiri atas populasi sel yang tersebar di dalam matrik ekstraseluler. Secara embriologi, jaringan ikat berasal dari lapisan mesoderm. Se-sel tersebut mensistesis matriks, dengan anyaman serat yang tertanam di dalamnya (Campbell et al. 1999).
Jaringan ikat ini dapat dibedakan menjadi6, yaitu jaringan ikat longgar, jaringan ikat padat, jaringan lemak, jaringan darah, jaringan kartilagodan jaringan tulang.
Diantara enam tipe jaringan ikat, jaringan ikat longgar paling banyak ditemukan di dalam tubuh kita. Di dalam matriks jaringan ikat longgar ini hanya sedikit ditemukan serabut. Serabut penyusun jaringan ikat ini berupa kolagen. Fungsi utama jaringan ikat longgar adalah pengikat dan pengepak material, dan sebagai tumbuhan bagi jaringan dan organ lainnya. Jaringan ikat longgar di kulit membatasi dengan otot. Jaringan ikat padat/fibrous mempunyai matriks yang banyak mengandung serabut kolagen. Jaringan ini membentuk tendon sebagai tempat perlekatan otot dengan tulang, dan ligamen sebagai tempat persendian tulang dengan tulang.
Jaringan lemak mengandung sel-sel lemak. Jaringan ini digunakan sebagai bantalan, dan melindungi tubuh, serta sebagai penyimpan energi. Setiap sel lemak, mengandung tetes lemak yang besar. Didalam jaringan lemak, matriks relatif sedikt.
Darah adalah jaringan ikat yang tersusun sebagian besar cairan. Matriks darah disebut plasma, yang tersusun oleh air, garam mineral, dan protein terlarut. Sel darah merah dan putih tersuspensi di dalam plasma. Darah ini berfungsi utama dalam transpor substansi dari satu bagian tubuh ke bagian lain. Disamping itu, darah juga berperan dalam sistem kekebalan.
Kartilago adalah jaringan ikat yang membentuk material rangka yang fleksibel dan kuat, terdiri atas serabut kolgen yang tertanam di dalam matriks. Kartilago banyak ditemukan pada bagian ujung tulang keras, hidung, telinga, dan vertebrae (ruas-ruas tulang belakang).
Tulang keras (bone) merupakan jaringan ikat yang kaku, keras, dengan serabut kolagen yang tertanam di dalam matriks.
Didalam matriks sel tulang terdapat kalsium yang dapat bergerak dan diserap oleh darah. Hal ini merupakan peran penting tulang dalam proses homeostasis kadar kalsium dalam darah. Sel tulang (osteosit) terdapat di dalam ruang yang disebut lakuna. Lakuna ini mengandung satu atau beberapa osteosit. Penjuluran yang keluar dari osteosit disebut kanalikuli. Kanalikuli dari satu sel berhubungan dengan sel lainnya, sebagai bentuk komunikasi sel. Satu osteon terdiri dari sejumlah lamela konsentris yang mengelilingi kanal sentral (kanalis Haversi). Pada individu yang masih hidup, kanal sentral ini berisi pembuluh darah.
c. Jaringan Otot
Secara embriologi, jaringan otot berasal dari lapisan mesoderm. Jaringan ini terdiri atas sel-sel yang memanjang atau berbentuk serabut yang dapat berkontraksi karena adanya molekul miofibril. Pada vertebrata, secara tipikal mempunyai tiga jenis otot, yaitu otot skelet (rangka), otot jantung (cardiac), dan otot polos.
Otot skelet berstruktur bergaris melintang, berfungsi untuk menggerakkan rangka. Otot ini bersifat sadar (voluntary), karena mampu diatur oleh kemauan kita. Serabut ototnya mempunyai banyak nukleus yang terletak ditepi. Otot rangka mempunyai garis melintang yang gelap (pita anisotrop) dan garis terang (pita isotrop).
Otot jantung merupakan otot bergaris melintang dan bercabang. Sifat otot ini tidak sadar (involuntary), karena kontraksinya tidak bisa diatur oleh kemauan kita. Nukleus terletak ditengah sel. Pada bagian ujung sel, terdapat sambungan rapat, yang membentuk struktur pembawa sinyal untuk kontraksi dari satu sel ke sel lainnya selama denyut jantung.
Otot polos berbentuk seperti spindle. Kontraksi otot polos lebih lambat dinbbandingkan otot skelet, namun mereka mampu kontraksi dalam waktu lebih lama. Otot polos bersifat tidak sadar (involuntary), seperti otot jantung. Otot polos ditemukan pada banyak organ tubuh, diantaranya terdapat pada dinding pembuluh darah dan melapisi organ dalam seperti usus dan uterus. Membran plasmanya disebut sarkolema dan sitoplasmanya sering disebut sarkoplasma. Sitoplasma yang mengandung miofibril dengan ketebalan mencapai 1 mikron.
d. Jaringan Saraf
Jaringan saraf merupakan alat koordinasi pada segala aktifitas hewan disebabkan karena ada sistem saraf. Satu sistem saraf dibangun atas sel-sel saraf (neuron) sebuah sel saraf mempunyai satu badan sel kemudian dari badan sel ini keluar tonjolan-tonjolan sitoplasma, yakni dendrit dan neurit (akson).
Jaringan saraf berperan dalam penerimaan rangsang dan penyampaian rangsang. Secara embriologi, jaringan ini berasal dari lapisan ektoderm. Jaringan ini terdapat pada sistem saraf pusat (otak dan sumsum tulang belakang) dan pada sistim saraf tepi. Ada dua macam sel, yaitu sel saraf (neuron) dan sel pendukung (sel glia). Neuron mengandung badan sel, nukleus, dan penjuluran atau serabut. Satu tipe penjuluran tersebut adalah dendrit, yang berperan dalam menerima sinyal dari sel lain dan meneruskannya ke badan sel. Tipe penjuluran sel saraf yang lain, disebut akson (neurit), yang berperan dalam meneruskan sinyal dari badan sel ke neuron lainnya. Beberapa akson berukuran sangat panjang, yaitu memanjang dari otak sampai ke bagian bawah abdomen (panjang 1/2 meter atau lebih). Transmisi sinyal dari neuron ke neuron lainnya umumnya dilakukan secara kimia. Selain neuron, ditemukan juga sel pendukung, seperti sel glia. Sel glia merupakan sel yang menunjang dan melindungi neuron. Sel-sel pendukung umumnya berperan dalam melindungi dan membungkus akson dan dendrit, sehingga membantu mempercepat transmisi sinyal.

C. Alat dan Bahan
1. Alat
a. Mikroskop
2. Bahan
a. Preparat epitel silidris
b. Preparat jaringan tulang keras
c. Preparat jaringan otot jantung dan otot rangka serta otot polos.

D. Prosedur Kerja
1. Preparat epitel silidris

2. Preparat jaringan tulang keras

3. Preparat Jaringan Otot


4. Preparat Jaringan Darah 

F. Hasil pengamatan
Berdasarkan praktikum yang telah dilakukan telah diperoleh hasil pengamatan sebagai berikut:
1. Penampang Epitel silindris (perbesaran 40x)
Hasil Foto Hasil Gambar

a. Membrane basal
b. Lumen
2. Jaringan Otot Polos (Perbesaran 100x)
Hasil Foto Hasil Gambar

a. Serat otot polos

3. Jaringan Tulang Keras (Perbesaran 100x)
Hasil Foto Hasil Gambar

a. Saluran Havers
b. Lamela
4. Jaringan Otot Lurik (perbesaran 100x)
Hasil Foto Hasil Gambar

a. Serat Melintang

5. Jaringan Otot Jantung (perbesaran 100x)
Hasil Foto Hasil Gambar

a. Serat otot
6. Jaringan Darah (perbesaran 100x)
Hasil Foto Hasil Gambar

a. Sel darah merah

F. Pembahasan
Berdasarkan hasil pengamatan pada preparat jaringan penyusun tubuh hewan dengan menggunakan mikroskop cahaya didapat bahwa jaringan penyusun tubuh hewan terdiri atas:

1. Epitel silindris
Berdasarkan hasil pengamatan menggunakan mikroskop dengan perbesaran 10x10, bagian-bagian epitel silindris nampak sangat jelas.
Epitel silindris dapat dibedakan menjadi dua, yaitu epitel silindris selapis dan epitel silindris berlapis. Sel epitel silindris ada yang memiliki silia pada daerah permukaannya, seperti pada oviduk. Contoh epitel selapis silindris adalah kantong empedu, lambung, saluran pernapasan bagian atas, dan jonjot usus.
Epitel silindris berlapis adalah jaringan epitel yang jarang ditemukan dan terdiri atas dua lapis. Fungsi jaringan epitel berlapis adalah sebagai tempat adsorpsi, ekskresi, sebagai pelindung gerakan zat melewati permukaan dan sebagai saluran ekskresi kelenjar ludah dan kelenjar susu. Contohnya epitel pada konjungtiva palpebra.
2. Preparat jaringan tulang keras
Berdasarkan hasil pengamatan menggunakan mikroskop dengan perbesaran 40x10 terlihat bagian yaitu saluran havers, lakuna, oeston dan kanakuli.
Kanalikuli adalah saluran kecil yang menghubungkan lakuna bersama serta memiliki fungsi sebagai lorong yang dilalui nutrisi ke osteosit dan mengeluarkan produk limbah. Lakuna adalah ruang kecil yang mengandung sel-sel tulang, atau dikenal sebagai osteosit.
Kanalikuli ditemukan baik pada tulang kompak dan kenyal. Tulang kompak juga banyak yang lebih besar dan tulang panjang tubuh manusia, dan tulang spons berisi sumsum tulang. Dalam tulang spons, kanalikuli adalah bagian dari trabekula, dan sumsum tulang merah terletak di ruang antara trabekula tersebut. Tulang spons juga memungkinkan osteosit untuk menerima makanan dari sel darah merah.
Tulang kompak terdiri dari sistem-sistem havers. Setiap sistem havers terdiri dari saluran havers (kanalis saluran) yaitu suatu saluran yang sejajar dengan sumbu tulang, di dalam saluran terdapat pembuluh-pembuluh darah dan saraf. Di sekeliling sistem havers terdapat lamela-lamela yang konsentris dan berlapis-lapis. Di dalam lakuna terdapat osteosit, yaitu sel-sel tulang dewasa. Dari lakuna menuju ke segala arah saluran-saluran kecil yang kanalikuli yang berhubungan dengan lakuna lain atau kanalis havers.
3. Preparat jaringan otot polos
Berdasarkan pengamatan pada mikroskop dengan perbesaran 10x10, terdapat beberapa bagian dalam otot polos yaitu gelondong, serat dan inti sel.
Otot ini dibentuk dari sel otot serabut kontraktil yang homogen. Oleh karena itu, serabutnya sukar diamati dibawah mikoskop cahaya. Intisel satu dan terletak ditengah sel. Otot polos terdapat di bagian tubuh yang melakukan gerak lambat dan di bawah pengaruh saraf otonom. Otot polos terdapat pada lambung, uterus, kantong lemak, dan pembuluh darah. Gerakan kontraksinya bergelombang dan meluas.
Sel-sel otot polos berbentuk seperti gelendong dengan nukleus tunggal yang terletak ditengah. Ukurannya bervariasi. Otot polos bekerja tidak menurut kemauan kita dan mampu untuk bekerja dengan waktu yang lama. Sel-sel otot polos dilengkapi dengan saraf yang berasal dari sistem saraf tak sadar. Otot polos terdapat pada dinding semua organ tubuh yang berlubang (kecuali jantung), misalnya pembuluh darah, usus, kantung kemih, dan rahim.
4. Preparat jaringan otot jantung
Berdasarkan pengamatan menggunakan mikroskop dengan perbesaran 4x10 terlihat bagian-bagian dari jaringan otot ini yaitu serabut otot dan intinya. Otot jantung mempunyai struktur yang sama dengan otot lurik hanya saja serabut-serabutnya bercabang-cabang dan saling beranyaman. Letak inti sel di tengah. Dengan demikian, otot jantung disebut juga otot lurik yang bekerja tidak menurut kehendak. Fungsi otot jantung adalah untuk memompa darah keluar jantung. Pada jaringan otot jantung nukleus di pusat.
Otot jantung adalah uniselular dan tidak multiselular. Sel-sel otot jantung tersusun seperti anyaman bercabang dengan sedikit jaringan penyambung disekelilingnya. Nukleus otot jantung terletak di tengah. Pada jarak tertentu pada serabut otot ada garis melintang yang dikenal dengan nama cakram sisipan (intercalated disc). Serat-serat otot jantung lebih tebal daripada otot polos dan tersusun tidak homogen.

Di dalam otot jantung terdapat jaringan khusus yang disebut jaringan purkinje yang berfungsi merambatkan impuls dengan cepat. Otot jantung hanya ditemukan pada dinding jantung dan vena kava yang menuju jantung. Keistimewaan otot jantung adalah kemampuannya untuk berkontraksi secara ritmis dan terus menerus. Otot jantung bereaksi cepat terhadap stimulus dan mampu bekerja lama tanpa lelah.
5. Preparat otot serat melintang
Berdasarkan pengamatan menggunakan mikroskop dengan perbesaran 40x10 terlihat bagian dari jaringan ini yaitu inti serabut otot serat melintang gelap (anisotrop) dan terang (isotrop) yang tersusun berselang-selang, sel-selnya berbentuk silindris dan mempunyai periode beristirahat berkali-kali. Otot rangka ini memiliki kumpulan serabut yang di bungkus oleh fasia super fasialis. Otot serat melintang disebut juga dengan otot lurik. Fungsi otot lurik untuk menggerakkan tulang dan melindungi kerangka dari benturan keras.

G. Kesimpulan
kesimpulan yang dapat diperoleh dari praktikum ini adalah Jaringan adalah:
1. Pada dasarnya jaringan hewan tersusun atas jaringan otot jantung, jaringan serat melintang, epididimis, jaringan adiposa, compact bone, dan otot polos.
2. Terdapat perbedaan dari semua jaringan tersebut yang memiliki fungsi tertentu. Pada umumnya, jaringan bekerja di bawah kehendak. Tetapi ada juga yang bekerja tidak dibawah kehendak misalnya otot jantung.

DAFTAR PUSTAKA
Albert, Bruce. 1994. Biologi Molekular Edisi kedua.Jakarta: PT Gramedia Pustaka Utama.
Campbell. (2003). Biologi Edisi kelima. Jakarta. Erlangga.
Nugroho, L. (2004). Biologi dasar. Jakarta. Universitas Gadjah Mada.
Sumardi, I. (2004). Biologi Dasar. Jakarta. Universitas Gadjah Mada.

H. Jawaban Tugas
1. Sebutkan ciri-ciri dari jaringan epitel
Jawaban:
a. Sel-selnya terletak berdekatan dengan susunan tertentu, memiliki daerah pertautan yang jelas dan kuat.
b. Memiliki permukaan bebas dan sel-selnya dapat membentuk penjuluran sitoplasma dengan tujuan tertentu.
c. Lazimnya berdiri pada membran basal
d. Jarang sekali terdapat pembuluh darah didalamnya
2. Jaringan epitel dapat dibedakan berdasarkan fungsi dan jumlah lapisannya. Jelaskan.
Jawaban:
a. Epitel pipih (squamous)
Berdasarkan susunan sel terdapat epitel sederhana dan epitel kompleks.
Epitel pipih selapis untuk proses difusi, osmosis, filtrsai dan sekresi.
Terdapat pada pembuluh limfe, pembuluh darah kapiler, selaput
pembungkus jantung, selaput perut. Epitel pipih berlapis sebagai pelindung, terdapat pada epitel rongga mulut, rongga hidung dan esophagus.
b. Epitel batang (columnar/silindris)
Berdasarkan susunan sel terdapat epitel silindris berlapis tunggal dan epitel silindris berlapis. Epitel silindris berlapis tunggal berfungsi untuk penyerapan sari-sari makanan. Pada usus halus(jejunum dan ileum) dan untuk sekresi sebagai sel kelenjar. Epitel silindris berlapis banyak berfungsi sebagai pelindung dan sekresi. Epitel berlapis banyak semu (pseudocolumner) berfungsi berdasarkan untuk proteksi, sekresi dan gerakan yang melalui permukaan
c. Epitel kubus (cuboidal)
Berdasarkan susunan sel terdapat epitel kubus berlapis tunggal dan epitel kubus berlapis banyak. Epitel kubus berlapis tunggal berfungsi untuk sekresi dan pelindung, terdapat pada lensa mata dan nefron ginjal. Epitel kubus berlapis banyak berfungsi sebagai pelindung dari gesekan dan pengelupasan,sekresi dan absorbsi.
d. Epitel Transisional
Merupakan jaringan epitel yang tidak dapat dikelompokkan berdasarkan bentuknya karena bentuknya berubah. Terdapat pada uretra dan kantong kemih.
e. Epitel kelenjar
Merupakan jaringan epitel yang khusus berperan untuk sekresi zat untuk membantu proses fisiologis. Dibedakan menjadi kelenjar eksokrin dan endokrin. Kelenjar eksokrin merupakan kelenjar yang berada di jaringan kulit atau bawah kulit yang berfungsi untuk membantu metabolisme dan komunikasi. Kelenjar endokrin merupakan kelenjar yang terletak di dalam tubuh dan sering disebut sebagai kelenjar buntu karena tidak mempunyai saluran bagi sekretnya sehingga langsung dilepas ke darah yang berfungsi untuk metabolism.

 

pemisahan dan pemurnian

12 November 2017 12:18:11 Dibaca : 65

BAB I
PENDAHULUAN
A. Judul :
Pemisahan dan Pemurnian

B. Rumusan Masalah
1. Bagaimana pemisahan zat-zat padat dari zat cair dengan cara penyaringan?
2. Bagaimana pemurnian melalui proses destilasi?

C. Tujuan
1. Mahasiswa dapat memisahkan zat-zat padat dari zat cair dengan cara penyaringan.
2. Mahasiswa dapat memurnikan zat padat dengan cara destilasi.

D. Manfaat
Agar praktikan dapat memisahkan zat-zat padat dari zat cair dengan cara penyaringan dan dapat memurnikan memurnikan zat padat dengan cara destilasi.

BAB II
KAJIAN TEORI
Kebanyakan materi terdapat di bumi ini tidak murni, tetapi berupa campuran dari berbagai komponen, contohnya tanah terdiri dari berbagai senyawa dan unsur baik dalam wujud padat, cair, atau gas.Udara yang kita hirup setiap hari mengandung berbagai macam unsur dan senyawa, seperti oksigen, nitrogen, dan sebagainya.Demikian juga air yang kita gunakan sehari- hari bukanlah air murni, melainkan mengandung zat-zat lain dalam bentuk gas, cair,atau padatan. Untuk memperoleh zat murni kita harus memisahkannya dari campurannya, contohnya untuk mendapatkan air suling (aquades) kita harus menyulingnya dari air sumur atau sungai.Untuk memperoleh minyak goreng kita harus memisahkannya dari buah kelapa atau biji jagung.
Cara atau teknik pemisahan campuran bergantung pada jenis, wujud, dan sifat campuran yang terkandung di dalamnya.Jika komponen berwujud padat dan cair, misalnya pasir dan air, dapat dipisahkan dengan saringan.Saringan bermacam-macam, mulai dari porinya yang sangat halus, contohnya kertas saring dan selaput semipermeabel.Kertas saring dipakai untuk memisahkan endapan atau padatan dari pelarut.Selaput semipermeabel dipakai untuk memisahkan suatu koloid dari pelarutnya (Syukri, 1999: 15).
Dalam melakukan pemisahan dan pemurnian diperlukan pengetahuan dan keterampilan. Terutama jika harus memisahkan komponen dengan kadar yang sangat kecil. Untuk tujuan itu dalam ilmu kimia telah dikembangkan berbagaicara pemisahan. Dari pemisahan sederhana yang sering dilakukan sehari-hari sampai metode pemisahan dan pemurnian yang kompleks atau tidak sederhana (Bahti, 1998 : 109).
Pemisahan berhubungan dengan campuran.Campuran adalah satu contoh materi yang tidak murni, yaitu bukan sebuah unsur atau sebuah senyawa.Campuran dapat berupa campuran homogen dan heterogen.Campuran homgen (larutan) adalah campuran unsur-unsur dan atau senyawa yang mempunyai susunan seragam.Selain itu, juga merupakan penggabungan zat tunggal atau lebih yang semua partikelnya berubah merata sehingga membentuk satu fase. Campuran homogen mempunyai komposisi yang sama pada setiap bagiannya dan juga memiliki sifat-sifat yang sama diseluruh cairan. Sedangkan campuran heterogen adalah campuran yang komponen-komponennya dapat memisahkan diri secara fisik karena perbedaan sifatnya dan penggabungan yang tidak merata antar dua zat tunggal atau lebih sehingga perbandingan komponen yang satu dengan yang lain tidak sama. Campuran heterogen memiliki dau fase, sehingga sifat-sifatnya tidak seragam (Petrucci, 1987 : 80).
Campuran homogen seperti alkohol dalam air, tidak dapat dipisahkan saringan, karena partikelnya lolos dalam pori-pori kertas saring dan selaput semipermeabel. Campuran seperti itu dapat dipisahkan dengan cara fisika yaitu destilasi, ekstraksi, dan kromatografi (Syukri, 1999: 16).
Campuran dapat dipisahkan dengan menggunakan berbagai macam metode. Metode-metode tersebut yaitu pengayakan, penyaringan, sentrifugasi, evaporasi, pemisahan campuran menggunakan magnet, sublimasi, destilasi, corong pisah, dan kromatografi (Mikarjudin, 2007 : 195).
Karena perbedaan keadaan agregasi (penampilan materi) sangat mempengaruhi metode pemisahan dan pemurnian yang diperlukan, maka dapat dibedakan menjadi :
a. Memisahkan zat padat dari suspensi
Suspensi adalah sistem yang mengandung partikel sangat kecil, setengah padat, atau cairan.
- Penyaringan (filtrasi)
Proses ini adalah pemisahan endapan dari larutan induknya, sasarannya adalah agar endapan dan medium penyaring secara e0uu[-kuantitatif bebas dari larutan.
b. Memisahkan zat padat dari larutan
Pada penguapan, larutan dipanaskan sehingga pelarutnya meninggalkan zat terlarut.Pemisahan terjadi karena zat terlarut mempunyai yang lebih tinggi daripada pelarutnya.
- Kristalisasi
Kristalisasi adalah larutan pekat yang didinginkan sehingga zat terlarut mengkristal.Hal itu terjadi karena kelarutan berkurang ketika suhu diturunkan.Apabila larutan tidak cukup pekat, dapat dipekatkan lebih dahulu dengan jalan penguapa, kemudian dilanjutkan dengan pendinginan melalui kristalisasi diperoleh zat padat yang lebih murni karena komponen larutan yang lainnya yang kadarnya lebih kecil tiadk ikut mengkristal (Pramono, 2012).
c. Memisahkan campuran zat cair.
- Destilasi
Dasar pemisahan dengan destilasi adalah perbedaan titik didih dua cairan atau lebih. Jika campuran dipanaskan maka komponen yang titik didihnya lebih rendah akan menguap terlebih dahulu. Kita dapat mengembunkan komponen demi komponen secara bertahap, dengan menghadirkan uap ketabung pendingin.Contohnya, memisahkan campurn air dan alkohol.Titik didih air dan alkohol masing-masing 100⁰C dan 78⁰C. Jika campuran dipanaskan sekitar 78⁰C, maka alkohol akan menguap sedikit demi sedikit. Uap itu mengembun dalam pendingin dan akhirnya didapatkan cairan alkohol murni (Syukri, 1999: 20).
- Dekantansi (Pengendapan)
Dekantasi (pengendapan) merupakan proses pemisahan suatu zat dari campurannya dengan zat lain. Cara pengendapan didasarkan pada massa jenis yang lebih kecil akan berada pada lapisan bagian bawah atau mengendap. Selain itu, zat terlarut (yang akan dipisahkan) diproses diubah menjadi bentuk yang tak larut, lalu dipisahkan dari larutan (Bahti, 1998 : 115).
d. Rekristalisasi dan Penyulingan
Rekristalisasi adalah proses pertumbuhan Kristal-kristal baru dari Kristal-kristal sebelumnya yang telah mengalami deformasi. Proses rekristalisasi membutuhkan pergerakan dan penyusunan kembali atom-atom. Penyusunan kembali untuk rekristalisasi ini lebih mudah terjadi pada suhu tinggi.Destilasi dan penyulingan adalah suatu metode pemisahan bahan kiia berdasarkan perbedaan kecepatan dan kemudahan menguap (volatilitas) bahan atau didefinisikan juga teknik pemisahan kiia yang berdasarkan perbedaan titik didih. Dalam penyulingan, campuran zat didihnya menguap dan uap ini kemudian didinginkan kembali kedalam bentuk cairan, zat yang memiliki titk didh yang rendah akan menguap terlebih dahulu. Metode ini termasuk unit operasi kimia jenis perpindahan massa. Penerapan proses ini didasarkan pada teori bahwa pada suhu suatu larutan, masing-masing komponen akan menguap pada titik didihnya (Partana, 2008).
e. Ekstraksi
Pemisahan campuran dengan cara ekstraksi berdasarkan perbedaan kelarutan komponen dalam pelarut yang berbeda. Campuran dua komponen (misalkan a dan b) dimasukkan kedalam pelarut x dan y. Syaratnya kedua pelarut ini tidak dapat bercampur, seperti air dan minyak.Semuanya dimasukkan dalam corong pisah dan dikocok agar bercmpur sempurna dan kemudian didalamnya didiamkan sampai pelarut x dan y memisah kembali. Kini zat a dan b berada dalam kedua pelarut x dan y, tetapi perbandingannya tidak sama. Misalkan a lebih banyak larut di x, sedangkan b lebih banyak di y. Maka a dan b telah terpisah walau tidak sempurna.Kedua pelarut dapat dipisahkan dengan membukanya kran corong perlahan-lahan dan ditampung dalam bejana yang bersih. Jumlah b dalam x dapat dikurangi dengan menambahkan y sehingga b lebih ditarik lebih banyak ke y. Demikian juga untuk menarik a dari pelarut y dengan menambahkan pelarut x. Jika hal ini dilakukan berulang-ulang maka a dan b akan terpisah makin sempurna (Syukri, 1999: 17).
f. Kromatografi
Kromatografi adalah teknik pemisahan campuran dalam berbagai wujud, baik padat, cair, maupun gas. Cara ini dipakai jika campuran tidak dapat dipisahkan dengan cara yang lain. Dasar kromatografi adalah perbedaan gaya atau daya serap suatu zat dengan zat lainnya (Syukri, 1999: 17).

BAB III
METODE PERCOBAAN
A. Tempat dan Waktu
Tempat pelaksanaan praktikum di laboratorium kimia B, lantai 2 fakultaltas MIPA, Universitas Negeri Gorontalo. Pukul 13.00-15.00 WITA. Pada hari rabu, tanggal 1 November 2017 .

B. Alat dan Bahan
1. Alat
No Nama Alat Gambar Kategori Fungsi
1 Gelas kimia
I Digunakan sebagai wadah dari suatu larutan
2 Cawan penguapan

I Sebagai wadah untuk menguapkan larutan

3 Gelas ukur

I Sebagai tempat mengukur volume larutan

4 Corong

I Digunakan sebagai wadah untuk penyaringan dari suatu larutan
5 Batang Pengaduk I Digunakan untuk mengaduk cairan

6 Penangas Listrik
II Berfungsi untuk memanaskan bahan yang akan di uji coba
7 Erlenmeyer I Digunakan untuk proses titrasi untuk menampung larutan yang akan di titrasi
8 Spatula
I -Untuk mengambil bahan kimia dalam bentuk padatan.
-Digunakan untuk mengaduk dalam pembuatan larutan kecuali larutan asam.
9 Mortal dan Alu
I Berfungsi untuk menggerus dan menghaluskan suatu zat

2. Bahan

No. Nama Bahan Kategori Sifat Fisik Sifat Kimia
1 Garam dapur Umum -Mudah hancur
-Larut dalam air
-Tidak bisa melewati selaput semipermeabel -pH netral
-Merupakan elektron kuat,karena terionisasi pada air

2 Kapur Tulis Umum Tidak mudah hancur Tidak larut dalam air
3 Aquades Umum -Tak berwarna
-Titik didih 100 oC
-Titik Beku 0 oC -Tidak mudah terbakar
-Pelarut banyak jenis zat
4 Pasir Umum Berbentuk butiran butiran kasar Tidak dapat larut dalam air
5 Naftalen Khusus -Bahan keras
-Berwarna putih
-Berbau khas -Uapnya mudah terbakar
-Berbentuk dua cincin yang bersatu
6 Kertas saring Umum Bersifat kuat Dapat larut dalam pelarut organik miaslnya CCl4

3. Prosedur Kerja

1. Proses dekantasi pasir dan air
Pasir ±1 spatula

2. Proses filtrasi (penyaringan)

Memasukkan bubuk kapur tulis kedalam gelas kimia yang berisi air
Mengaduk
Menyiapkan corong dan kertas saring
Menyaring

3. Proses kristalisasi

4. Proses kristalisasi

 

BAB IV
HASIL PENGAMATAN DAN PEMBAHASAN
A. Hasil Pengamatan
No. Perlakuan Pengamatan
1 Dekantasi:
- Mencampurkan ± 1 sendok pasir dengan 50 ml aquadest lalu diaduk.
- Mendiamkan larutan pasir.
- Menuangkan larutan bagian atas.
- Warna aquades berubah menjadi keruh atau berwarna coklat.
- Pasir mengendap di gelas kimia karena tidak tercampur dengan aquadest.
- Larutan berwarna coklat dan keruh.
2 Filitrasi:
- Melarutkan 1 sendok kapur yang sudah dihaluskan kedalam gelas kimia.
- Mencampurkan dengan aquades.
- Menyaring larutan kedalam erlenmeyer dengan menggunakan corong.
- Kapur berbentuk padatan.
- Wrna aquades menjadi putih susu karena kapur sebagian tercampur dengan aquades.
- Warna aqudes menjadi bening dan ada kapur yang tertinggal didalam kertas saring.
3 Kristalisasi:
- Memasukan 1 sendok garam kedalam gelas kimia lalumencampurkan 25 ml larutan aquades lalu diaduk.
- Menyaring larutan garam dengan menggunakan tissue dan corong.
- Meletakan larutan garam dicawan penguapan dan diletakan di penangas.
- Larutan garam menjadi keruh.
- Larutan garam menjadi bening.
- Larutan menjadi kristal.
4 Sublimasi:
- Menghaluskan 2 butir naftalen.
- Memasukan kecawan penguapan.Meletakan keatas penangas listrik dan ditutup dengan kertas saring pada ujung corong tersebut.
- Naftalen berbentuk padatan.
- Naftalen yang menguap menempel dikertas saring dalam bentuk kristal.

B. Pembahasan
Pada prinsipnya, pemisahan dilakukan untuk memisahkan dua zat atau lebih yang saling bercampur dan pemurnian dilakukan untuk mendapatkan zat murni dari suatu zat yang telah tercemar oleh zat lain. Teknik pemisahan dan pemurnian dari suatu zat yang telah tercemar atau mengalami pencampuran dapat dilakukan dengan beberapa cara diantaranya penyaringan, kristalisasi, dekantasi, absorpsi, sublimasi, ekstraksi, dan sebagainya.
1. Proses dekantasi pada pasir dan air
Dekantasi merupakan cara pemisahan zat padat yang tidak larut dalam air dengan cara diendapkan. Pada percobaan kali ini, digunakan pasir dan air untuk mengetaui proses dekantasi. Langkah pertama yang dilakukan dalam percobaan ini yaitu memasukkan ± 1 sendok pasir ke dalam gelas kimia yang telah terisi air sebanyak 80 ml. Kemudian pasir dan air diaduk secara merata.Setelah diaduk, terlihat bahwa pasir tidak larut dalam air dan mengendap di dasar gelas.Lalu menuangkan larutan bagian atasnya untuk dipisahkan dari pasir yang mengendap di dasar gelas kimia. Pada percobaan ini bekerja prinsip Archimedes dimana massa jenis pasir lebih besar daripada massa jenis air sehingga pasir tenggelam atau mengendap di dasar gelas kimia. Hasil dari proses dekantasi ini adalah filtrate berupa air keruh dan residu berupa pasir yang tidak mengalami perubahan bentuk. Pemisahan dengan cara dekantasi ini belum dapat memisahkan larutan dengan baik sebab pada larutan bagian atas tadi yang dipisahkan dari endapan pasir masih terdapat kristal-kristal pasir. Sehingga air hasil pemisahan ini tidak jernih seperti sebelum pencampuran, melainkan menjadi keruh.Reaksi persamaannya adalah:

2H2O(aq) + SiO4(s) Si(OH)4(l)

2. Proses filtrasi (penyaringan)
Filtrasi adalah proses pemisahan padatan dari cairan dengan menggunakan bahan berpori yang hanya dapat dilalui oleh cairan. Penyaringan biasanya menggunakan kertas daring yaitu kertas yang porinya relative kecil sehingga dapat menahan partikel suspense.Pada percobaan kali ini, digunakan bubuk kapur tulis (CaCO3) dan air.Langkah pertama yang dilakukan yaitu dengan memasukkan ± 1 sendok bubuk kapur tulis ke dalam air sebanyak 80 ml. kemudian diaduk, setelah diaduk dilakukan penyaringan dengan menggunakan corong dan kertas saring.Hasil dari percobaan ini yaitu bubuk kapur tulis sebagai residunya dan air jernih sebagai filtratnya.Hal ini terjadi karena air dan kapur tulis bersifat heterogen saat dicampurkan, penyaringan pada CaCO3 bertujuan untuk mendapatkan hasil pemisahan antara keduanya.Hasilnya yaitu kapur yang mengendap pada kertas saring dan air yang menjadi jernih dari sebelum penyaringan.Hal ini terjadi karena semua komponen yang berupa padatan dan campuran kapur tulis dan air telah tersaring dan mengendap pada kertas saring sedangkan air berupa cairan.
Persamaan pada percobaan ini:

CaCO3(s) + H2O(aq) Ca(OH)2 + CO2

3. Proses kristalisasi
Cara pemisahan ini dilakukan dengan cara penguapan, pemisahan dengan cara penguapan ini bertujuan untuk memisahkan air dan garam, sehingga bahan yang digunakan adalah air dan garam dapur. Langkan pertama yang dilakukan pada percobaan ini adalah memasukkan air sebanyak 25 ml ke dalam gelas kimia.Kemudian memasukkan garam dapur ke dalam gelas kimia yang telah berisi air tadi, kemudian diaduk hingga merata. Sebagian garam dapur yang dimasukkan ke dalam gelas kimia yang berisi air larut dan bersifat homogen dengan air dengan diberi perlakuan yang dapat mempercepat proses pelarutan yaitu dengan mengaduknya. Sedangkan sebagian garam yang lain tidak larut dalam air karena larutan telah menjadi jenuh. Kemudian dilakukan penyaringan dengan menggunakan corong dan kertas saring. Setelah penyaringan, filtrat yang didapatkan yaitu larutan garam yang selanjutnya akan diuapkan. Walaupun hasil penyaringan menjadi jernih kembali seperti sebelum dilakukan pencampuran, namun karena garam larut dalam air, maka dalam larutan tersebut masih terdapat partikel garam yang tidak tersaring oleh kertas saring. Oleh karena itu, perlu dilakukan penguapan dengan menggunakan cawan penguapan dan heater mantel sampai terbentuk kembali kristal NaCl (kristal garam murni).
Persamaan reaksi pada percobaan ini:

NaCl(s) + H2O(aq) NaOH(g) + HCl(s)

4. Proses sublimasi
Sublimasi merupakan teknik pemisahan dan pemurnian dari suatu zat dari campurannya dengan jalan memanaskan campuran sehingga dihasilakan sublimat.Langkah pertama yang dilakukan pada percobaan ini yaitu memasukkan bubuk naftalenke dalam gelas kimia yang telah berisi air sebanyak 25 ml.Naftalen diberi perlakuan berupa pengadukan untuk mempercepat proses pelarutan naftalen dalam air. Hasilnya yaitu campuran homogen yang berwarna biru.Setelah naftalen larut dalam air, larutan ini kemudian dimasukan kedalam cawan penguapan.Kemudian ditutu dengan kertas saring,diatas kertas saring ditutup lagi dengan corong dan leher corong tersebut disumbat dengan tissue.Setelah itu diletakan di atas penangas listrik.Hasil dari percobaan ini naftalen berbentuk padatan dan dan menguap serta menempel pada kertas saring membentuk kristal.Persamaan reaksi dari percobaan in adalah:

C10H8(S) + H2O(aq) 10Co2(g) + 24H2(g)

Sebelum
Sesudah

1. Percobaan1
Sebelum Sesudah

2. Percobaan 2
Sebelum Sesudah

3. Percobaan 3
Sebelum Sesudah

4. Percobaan

4Daftar Pustaka
Bahti, Hasan H. 1998. Teknik Pemisahan Kimia dan Fisika. Bandung: ITB.
Mikarjudin. 2007. Kimia Dasar. Jakarta: Esis.
Partana, Fajar. 2008. Pemisahan dan Pemurnian Larutan. http://fajarpartana.blogspot.co.id (diakses 1 November 2016).
Petrucci, Ralph H. 1987. Kimia Dasar Jilid 1. Jakarta: Erlangga.
Pramono. 2012. Percobaan II. http://pramono.staff.uns.ac.id/percobaanII.pdf (diakses 27 Oktober 2016).
Syukri. 1999. Kimia Dasar I. Bandung: ITB.

 

 

perubahan kimia

12 November 2017 12:00:23 Dibaca : 24

BAB I
PENDAHULUAN

A. Judul
PERUBAHAN KIMIA

B. RumusanMasalah
1. Bagaimanagejalaterjadinyareaksikimia?
2. Bagaimanapenulisanpersamaanreaksikimia?

C. Tujuan
1. Praktikandapatmengamatigejalaterjadinyareaksikimia
2. Praktikandapatmenuliskanpersamaanreaksikimia

D. Manfaat
1. Agar praktikandapatmengamatiterjadinyasuatureaksikimia
2. Agar praktikandapatmengetahuipenulisandaripersamaanreaksikimia

BAB II
KAJIAN TEORI

Perubahan kimia adalah perubahan pada zat yang menghasilkan zat baru. Terdapat beberapa ciri-ciri perubahan kimia suatu zat yaitu, terbentuk zat baru. zat yang berubah tidak dapat berubah kembali kebentuk semula diikuti massa zat setelah reaksi. (sugiyanto, 2008:58)
Menurut (prabowo, 1997:25-6). Ciri yang mampu membedakan sesuatu zat satu dengan zat lain adalah sifat dari masing-masing zat yaitu zat fisik dan zat kimia. Sifat fisik merupakan sifat yang dapat diamati tanpa adanya perubahan susunan zat yang bersangkutan. Sedangkan sifat kimia menggambarkan bagaimana suatu zat berubah ketika bereaksi dengan suatu zat lain dan biasanya diikuti dengan perubahan energi. Sifat kimia akan teramati ketika suatu zat berubah susunannya.
Perubahan kimia yang disertai pengeluaran energi disebut energi eksoterm, energi yang dikeluarkan dapat berubah energi panas listrik, cahaya dan lain-lain.sedangkan perubahan kimia yang disertai penyerapan energi disebut reaksi endoterm. Pada perubahan kimia dihasilkan satu atau lebih materi yang berbeda dari sebelumnya.
Suatu perubahan kimia materi yang menghasilkan jenis dan sifat materi berbeda dari zat semula dinamakan perubahan kimia, (perubahan kimia dinamakan juga reaksi kimia). Misalnya pembakaran kayu, jika kayu dibakar akan menghasilkan arang kayu. Jika dibandingkan antara kayu dan arang kayu, keduanya memiliki jenis dan sifat yang berbeda. Karena itu pembakaran kayu bukan perubahan fisika, tetapi tergolong kimia. Dalam perubahan kimia dihasilkan jenis materi yang berbeda dengan materi semula. Sehingga terdapat dua istilah yang digunakan dalam reaksi kimia yaitu zat semula dinakan reaktan atau pereaksi, sedangkan zat yang terbentuk hasil reaksi. Pada pembakaran kayu dinamakan hasil reaksi. Dalam kehidupan sehari-hari banyak reaksi kimia yang terjadi seperti pada pembakaran minyak bumi, perkaratan besi, dan lainnya. Semua itu menghasilkan zat yang sifat dan jenisnya baru (sunarya, 2010:11).

Menurut (purba,2006:79). Perubahan kimia disebut reaksi kimia yang terjadi ketika zat-zat reaksi dicampurkan satu wadah, namun tidak setiap campuran disertai dengan reaksi kimia. Kadang-kadang tidak mudah untuk mengetahui apakah suatu reaksi kimia terjadi atau tidak. Meskipun demikian, pada umumnya reaksi kimia desertai dengan suatu perubahan yang dapat diamati.
1. Perubahan warna
Banyak zat kimia yang berwarna merupakan sifat khas zat artinya tidak ada zat yang berbeda yang mempunyai warna yang sama. Oleh karena iti, perubahan warna merupakan petunjuk telah terbentuk zat baru. Memudarnya warna pakaian menunjukkan terlah terjadi suatu reaksi kimia.
2. Perubahan suhu
Reaksi kimia selalu disertai pelepasan dan penyerapan energi. Bentuk energi yang menyertai reaksi kimia dapat berubah kalor (panas), cahaya atau listrik reaksi yang membebaskan kalor disebut reaksi eksoterm sedangkan yang menyerap kalor disebut reaksi endoterm.

3. Pembentukan endapan
Kelarutan zat dalam air sangat beragam ada yang mudah larut ada pula yang sukar larut. Garam dan gula merupakan dua contoh zat yang mudah larut, sedangkan batu dan pasir sangat sukar larut dalam air. Reaksi yang menghasilkan endapan adalah reaksi kimia yang menghasilkan zat yang sukar larut dan mengandap.
4. Pembentukan gas
Selain, perubahan warna, perubahan suhu, dan perubahan endapan . perubahan lain yang menandai berlangsungnya reaksi kimia adalah pembentukan gas. Gas hasil reaksi dapat diamati berupa gelembung yang keluar dari campuran pereaksi.

Menurut (kleinferter,1989:20-28). Tiap zat misalnya air, gula, garam, perak atau tembaga, memiliki seperangkat sifat atau ciri (karateristik) yang membedakannya dari semua zat lain dan memberinya identitas yang unik baik gula maupun garam berwarna putih padat, kristal, larut dalam air dan tak berbau. Tetapi gula manis, bila dipanaskan dalam belanga akan meleleh setelah dipanasi, sehingga membara, tidak menjadi coklat betapapun dipanasi didalam nyala api. Zat-zat ini diberikan dengan memaparkan beberapa sifat intrinsik merka masing-masing. Sifat intrinsik adalah kualitas yang bersifat khas dati setiap contoh zat, tidak peduli bentuk dan ukuran contoh itu. Sifat ekstrinsik ialah sifat yang tidak khas dari suatu zat itu sendiri ukuran, bentuk, bobot dan temperatur.
Kualitas yang khas dari suatu zat yang menyebabkan zat itu berubah, baik sendirian maupun dengan berantaraksi dengan zat lain dan dengan berubah itu membentuk bahan. Bahan berlainan disebut sifat kimia. Sifat kimia adalah sifat intrinsik. Misalnya etil alkohol mudah terbakar, besi berkarat dan kayu melapuk. Perubahan kimia mengakibatkan hilangnya zat-zat dan terbentuknya zat-zat baru. Tiga macam perubahan menjadi hasil reaksi yang mempunyai sifat, susunan, dan energi dalam yang belainan. Dalam beberpa hal perubahan itu begitu dinamis sehingga tidak diragukan lagi bahwa telah terjadi sesuatu perubahan kimia. Suatu perubahan warna atau pembentukan zat padat yang tidak larut merupakan indikasi terjadinya kimia atau pembentukan zat padat yang tak larut. Merupakan indikasi terjadinya kimia. Ketika perubahan mmenyertai reaksi kimia yaitu perubahan sifat, komposisi, dan energi (purba, 2008:40).

Macam-macam reaksi kimia
1. Reaksi penggabungan
Reaksi penggabungan adalah reaksi di mana dua buah zat bergabung membentuk zat ke tiga. Khusus paling sederhana adalah jika dua unsur bereaksi membentuk senyawa, misalnya:
2Na + Cl2 2NaCl

2. Reaksi penguraian
Reaksi penguraian adalah suatu reaksi senyawa tunggal membantuk dua atau lebih zat baru. Biasanya reaksi ini berlangsung dalam suhu tinggi agar terurai, misalnya:
KClO3 2KCl + 3O2
3. Reaksi pendesahan
Reaksi pendesahaan atau di sebut juga reaksi pertukaran tunggal adalah reaksi di mana suatu unsur bereaksi dengan senyawa menggantikan unsur yang terdapat dalam senyawa itu.
2Fe + Cu(NO3)2 Cu + Fe(NO3)2
4. Reaksi pertukaran ganda
Reaksi pertukaran ganda adalah reaksi yang melibatkan pertukaran bagian dari pereaksi. Jika pereaksi adalah senyawa ionik dalam bentuk larutan, bagian yang bertukaran adalah kation dan onion dan senyawa.
2KI + Pb(NO3)2 2KNO3 + PbI2
5. Reaksi pembakaran
Reaksi pembakaran adalah reaksi suatu zat dengan oksigen, biasanya bereaksi cepat di sertai pengelapan, Kalor membentuk nyala. Contoh pembakaran senyawa karbon :
CH4 + 2O2 CO2 + 2H2O
2CH3COOH + 3O2 2CO2 +4H2O
C4H10 + 13O 8CO2 + H2O
Reaksi-reaksi kimia dapat terjai di mana-mana pada mesin molal, gosulin yang di bakar untuk menguplai energi untuk menggerakan mobil, menghidupkan radio, dan menyalakan AC. Reaksi-reaksi kimia di dalam tubuh kita menyediakan energi untuk menggerakkan otot-otot kita. Di dalam reaksi kimia di dalam tumbuhan untuk mengubah CO2 (karbon dioksida)dan air menjadi karbohidrat.
Para ahli kimia menggambarkan reaktan,di dalam perubahan kimia zat yang di reaksikan berubah menjadi zat baru yang memiliki komposisi yang berbeda dan sifat-sifat yang baru meliputi perubahan kimia, karena atom dari zat yang berbentuk kombinasi baru memiliki sifat-sifat yang baru(Timberlake,2004:186)
Perubahan kimia membentuk zat baru karena terjadi perubahan susunan dalam struktur zat. Contohnya : besi berkarat, kayu terbakar, dan air menjadi hidrogen dan oksigen. Ilmu kimia sebagai ilmu pengetahuan alam yang mempelajari komposisi dan struktur zat kimia serta hubungan keduanya dengan sifat zat. Peristiwa fisika dan kimia komposisi (susunan) zat menyatakan perbandingan unsur yang membentuk zat. Contohnya air dan etanol, dengan rumus senyawa:
H2O dan C12 H5 OH
Berkat pengetahuan tentang kandungan dan struktur senyawa, ahli kimia telah berhasil membentuk banyak senyawa baru yang bermanfaat bagi kehidupan manusia seperti perabotan rumah tangga (plastik), produk kesehatan yaitu obat-obatan, dan produk untuk pertanian yaitu Pupuk dan plastida(Syukri,2010:2).
BAB III
METODE PERCOBAAN

A. TempatdanWaktu
Praktikumperubahankimia, di laksanakanpadaharirabu, 1 november 2017pukul 13.00 s/d 15.00 wita, bertempat di laboratoriumkimia, Jurusankimia, Fakultas MIPA, UniversitasNegeri Gorontalo.
B. AlatdanBahan
Tabel,Alat
No Nama alat Kategori Gambar Fungsi
1 Gelaskimia I
Sebagaiwadahatautempatzatkimia
2 Gelasukur I
Untukmengukur volume cairan
3 Tabungreaksi I
Untukmereaksikanzatkimia
4 Raktabungreaksi I
Wagah untukmeletakkantabungreaksi
5 Pipettetes I
Untukmengambillarutan
6 Spatula I
Untukmengambilzatkimia yang berbentukpadatan
7 Paku I
Sebagaialatujicoba
8 Kapas I
Untukmembalutpaku

Tabel,Bahan
No Nama bahan Kategori Sifatfifsika Sifatkimia
1 Magnesium (Mg) Khusus Nomor atom : 12
Memilikititikdidihyanhlebihbesardaripadatitiklelehnya Dapatbereaksi, Tidakbereaksiterhadap hydrogen
2 Asamklorida (HCl) Khusus Massa atom : 36,45
Massa jenis : 3,2
Titikleleh : -101
Energy ionisasi : 1250 Akan berasaptebal di udaralembab,Gasnyaberwarnakuningkehijauandanberbaumeransang
3 Asamasetat/ cuka (CH3COOH)

Khusus berbentukcairanjernih,
tidakberwarna,
berbaumenyengat Mudahmenguap di udaraterbuka,Mudahterbakar,
Dapatmenyebabkankorosifpadalogam.
4 Asamsulfat (H2SO4) Khusus Berbentukcairan, beratmolekul : 98,08 Mudahlarutdalam air dingin,
Larutdalam air denganpembesaran
5 Asamoksalat (H2C2O4) Khusus Berbentuk Kristal,
Berwarnaputih,
Tidakmenyerap air,
Beratmolekul 90,04 Larutdalam alcohol,Larutdalam air 5,25%, Mempunyaikelarutan yang sangatkecil
6 Kalium permanganate (KMnO4) khusus Berbentukpadatan,
Berwarnaungu, massajenis : 150,03,
Titikdidih 240 Larutdalam methanol,
Mudahterurai,
Oksidatorkuat

3. ProsedurKerja
• Percobaan 1

HCL
Mengambilserbuk mg secukupnya
Memasukankedalamlarutan yang beradadalamtabungreaksi
Mengamati yang terjadi

• Percobaan 2

H2SO4
memasukanserbuk mg secukupnya
memasukankedalamlarutandalamtabungreaksi
mengamati yang terjadi

• Percobaan 3

KMnO4
mengambillarutan H2C204 secukupnya
memasukankedalamlarutandalamtabungreaksi
mengamati yang terjadi

• Percobaaan 4

Paku
membalutdengankapas
meneteskan CH3COOH secaraperlahan
mendiamkanselama 20 menit
mengamati yang terjadi

BAB IV
PENGAMATAN DAN PEMBAHASAN
A. Hasil Pengamatan

Tabel, Pengamatan
No. Perlakuan pengamatan
1. Mengambil serbuk Mg secukupnya dan masukkan kedalam HCl yang telah berada didalam tabung reaksi dan mengamati hasil percobaan Menghasilkan gelembung-gelembung gas.
Lambat dan sukar menguap
Serbuk Mg sukar larut
Perubahan warna putih keruh
2. Mengambil Mg secukupnya dan masukkan kedalam larutan H2SO4 yang telah berada dalam tabung reaksi dan mengamati hasil percobaan Menghasilkan gelembung-gelembung gas
Menguap
Pada H2SO4 serbuk Mg lebih mudah larut
Warna menjadi putih / bening
3. Mengambil larutan H2C2O4 secukupnya dengan menggunakan pipet tetes dan dimasukkan kedalam tabung reaksi dan amati selama 20-30 menit Menghasilkan warna ungu terang
Setelah 17 menit warnanya berubah, bening kecoklatan
4. Mengambil paku kemudian balut dengan kapas dengan meneteskan cuka secukupnya secara perlahan sampai basah dan diamati selama 20 menit Paku terendam cuka mengalami perkaratan
Paku yang tidak terendam cuka tidak mengalami perkaratan
Paku yang dibalut dengan kapas tidak mengalami perkaratan

B. Pembahasan
Padapercobaansatu di reaksikanantaraserbuk Magnesium denganasamkloridadenganpersamaanreaksisebagaiberikut:
Mg(s) + 2HCl(l) MgCl2(aq) + H2(g)
Senyawa yang dihasilkanpadapersamaanreaksi di atasberupa magnesiumkloridaatau magnesium diklorida. Denganhidrogensebagaihasilreaksi yang bersifat gas sehinggapadawadahterbukaakanhabisteruraiberaksidenganudara. padasaatserbuk Mg di masukkankedalamlarutanasamklorida yang telah di siapkanpadatabungreaksiterjadigejalahreaksidiantaranya, timbulgelembung-gelembung gas yang lambatdansukarmenguapsertaterbentuknyabuihpadapermukaanlarutandanmengalamiperubahanwarnahmenjadiputihkeruh. Serbuk Mg padaasamkloridamudahterurainamunbersifatsukarlarutkarenanyamemerlukanwaktu yang lama untukmeraksikankeduasenyawatersebutsampaimembentukkesetimbangan yang di inginka

Gambarhasilpercobaan: 1

Padapercobaanduadireaksikanantaraserbuk magnesium denganasamsulfatmembentukpersamaanreaksisebagaiberikut..:
Mg(s) + H2SO4(s)MgSO4(aq) + H2(g)
Senyawa yang di hasilkanpadapersamaan di atasberupalarutan Magnesium Sulfat,degansenyawahidrogen yang merupakansenyawahasilakhirreaksi yang berbentuk gas, sehinggahidrogenpadawadahterbukaakanteruraiolehudara. Padasaat Mg dimasukkankedalamsenyawaAsamsulfat yang telah di tuangkankedalamtabungreaksiterjadigejalahreaksipadasenyawahasilcampurantidakmengalamiperubahanwarna yang signifikanmelainkantetapberwarnahbeningnamunsedikitlebihjernih.
Gambarhasilpercobaan: 2

Padapercobaantigalarutan H2C2O4 di pindahkandariwadahtertutupkewadahterbuka, dengantujuanuntukmereaksikansenyawa H2C2O4denganudaradanmembentukpersamaanreaksisebagaiberikut..:
2H2C2O4(l) + O2(g)CH3COOH(l) + 2CO2(g) + 2O2(g)
Senyawa yang di hasilkanberupaasamcuka.karbondioksidadanoksigen. Karbondioksidadanoksigenmerupakansenyawa yang berwujud gas sehinggapadawadahterbukasenyawatersebutakanmenguapdanterurai di udara. Padasaatmulamula di tuangkansenyawa H2C2O4memilikiwarnaungguterang, setelah di biarkanselamatujuhbelasmenit di wadahterbukalarutantersebutbereaksidenganudaradanmembentukgejalahreaksiberupaperubahanwarnamenjadibeningkecoklatan.
Gambarpercobaan: 3

Padapercobaanempatreaksi yang terjadimerupakanjenisreaksiperkaratan(korosi) denganbahanreaksiberupalarutanasamcukadenganprsamaanreaksiionisasinyasebagaiberikut..:
CH3COOH(l)H+ + CH3COO-
Padasaatpercobaanberlangsungselama 20 menitterbentukgajalahreaksidiantaranya..:
*paku yang terendamcukamengalamiperkaratan
*paku yang tidakterendamcuka,tidakmengalamiperkaratan
*paku yang di balutdengankapastidakmengalamiperkaratan
Hal ini di sebabkankarenapaku yang di gunakanmerupakansenyawalogam yang berpotensialreduksisertalarutanasamcuka yang merupakanfaktorutamaterbentuknyaperkaratanpadapaku, karenakorosiakansangatcepatterjadipadabahanlogam yang terkenalarutanbersifatasam. Paku yang di balutolehkapastidakmengalamiperkaratandikarenakanpadapercobaaninikapasberperansebagaipelindungmekanis, yang berfugsi agar larutanataupunudaratidakbersentuhanlangsungdenganpaku.
Gambarhasilpercobaan: 4

BAB V
KESIMPULAN DAN SARAN
KESIMPULAN
Dari percobaan yang kami lakukan, kami dapatmenyimpulknbahwaperubahankimiamerupakanperubahan yang terjadipadasuatuzatbaikberbentukpadat,cairmaupun gas. Perubahankimiasendiritidakluputdariberbagaimacamgejalahreaksisepertidiantaranyaperubahanbentuk,perubahanwarna,perubahanmateripenyusunyadanberbagaimacamperubahanlainya yang membuatzatataumateriberubahbentukpadasaatkesetimbanganberlangsung. Hanyasajaperubahankimiasedikitberbedahdenganreaksikimia, karenaperubahankimiameliputiseluruhaspekdaripenggabunganataupunperusakansuatuzatolehzat lain yang sifatnyaberbeda. Sementarareaksikimiahanyadapatmenjelaskan proses yang terjadipadasaatberjalanyareaksi.

SARAN
Saran kami, padasaatmelakukanpercobaanpraktikan di harapkanberhati-hatidalammemasukkansuatuzat yang memilikikadartinggikedalamtabungreaksidikarenakanzattersebutdapatmenyebabkanlukabakarpadabagian yang terkenazattersebut. Dan sebaiknyapadasaatpraktikumberlangsungpraktikanmengenakanperlengkapanpraktikumdenganbaik,karenasuatuzatpadasaat di reaksikanakanmelepaskan gas-gas berbahayakeudara yang jikaterhirupdapatmenyebabkansesaknafasdanmemicukerusakanfungsi organ.

DAFTAR PUSTAKA
Kleinfeiter,donaid C. 1989.ilmu kimia untuk unuversutas. Jakarta: erlangga
Prabowo,hadi. 1997. Ilmu kimia. Jakarta: Erlanga
Purba, michae. 2006. Ipa kimia. Jakarta erlangga
Sugiarto,T dan ismawati,E. 2008. Ipa kimia. Jakarta: prisma esta utama
Sukri.S.1999.kimia.dasar.1. bandung: ITB
Sunarya,yayan 2010. Kimia.dasar 1. Bandung: yrama widya
Timberlake,karea.C.2004.chemistry.stroctores.of.life

 

Chemistry

23 August 2017 13:14:04 Dibaca : 15

     Alhamdulillah puji syukur kepada Allah SWT serta solawat kepada Nabi SAW 

saat ini saya sudah masuk pada jenjang yg lebih menantang bagi saya dalam hal menuntut ilmu semoga ditempat ini saya mampu menjadi yg TERBAIK